No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00026137-M01 |
| Product name: | ZBTB20 monoclonal antibody (M01), clone 1F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZBTB20. |
| Clone: | 1F3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26137 |
| Gene name: | ZBTB20 |
| Gene alias: | DKFZp566F123|DPZF|HOF|ODA-8S|ZNF288 |
| Gene description: | zinc finger and BTB domain containing 20 |
| Genbank accession: | NM_015642 |
| Immunogen: | ZBTB20 (NP_056457, 451 a.a. ~ 542 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FLFSLPQPLAGQQTQFVTVSQPGLSTFTAQLPAPQPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVHTGEKPHQCSICWRSF |
| Protein accession: | NP_056457 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged ZBTB20 is 0.3 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |