Cart 89 Product Products 31 339,26 € (empty)
No products
To be determined Shipping
31 339,26 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 89 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 31 339,26 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 31 339,26 €
Data sheet of TRPC4AP monoclonal antibody (M07), clone 3G4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about TRPC4AP monoclonal antibody (M07), clone 3G4
| Brand: | Abnova |
| Reference: | H00026133-M07 |
| Product name: | TRPC4AP monoclonal antibody (M07), clone 3G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRPC4AP. |
| Clone: | 3G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26133 |
| Gene name: | TRPC4AP |
| Gene alias: | C20orf188|TRRP4AP|TRUSS |
| Gene description: | transient receptor potential cation channel, subfamily C, member 4 associated protein |
| Genbank accession: | NM_015638 |
| Immunogen: | TRPC4AP (NP_056453, 341 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VANEESEHNQASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSPD |
| Protein accession: | NP_056453 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TRPC4AP is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |