Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TRPC4AP polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about TRPC4AP polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00026133-A01 |
| Product name: | TRPC4AP polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TRPC4AP. |
| Gene id: | 26133 |
| Gene name: | TRPC4AP |
| Gene alias: | C20orf188|TRRP4AP|TRUSS |
| Gene description: | transient receptor potential cation channel, subfamily C, member 4 associated protein |
| Genbank accession: | NM_015638 |
| Immunogen: | TRPC4AP (NP_056453, 341 a.a. ~ 451 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VANEESEHNQASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSPD |
| Protein accession: | NP_056453 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.32 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | TRPC4AP polyclonal antibody (A01), Lot # GSK10060112QCS1. Western Blot analysis of TRPC4AP expression in Raw 264.7. (Isoform : 59.546 kDa) |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |