FGFR1OP2 polyclonal antibody (A01) View larger

FGFR1OP2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FGFR1OP2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FGFR1OP2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00026127-A01
Product name: FGFR1OP2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant FGFR1OP2.
Gene id: 26127
Gene name: FGFR1OP2
Gene alias: DKFZp564O1863|HSPC123-like
Gene description: FGFR1 oncogene partner 2
Genbank accession: NM_015633
Immunogen: FGFR1OP2 (NP_056448, 62 a.a. ~ 169 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDPGIIMKLKEQHSKIDMVHRNKSEGFFLDASRHILEAPQHGLERRHLEANQ
Protein accession: NP_056448
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026127-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FGFR1OP2 polyclonal antibody (A01) now

Add to cart