| Brand: | Abnova |
| Reference: | H00026121-M02 |
| Product name: | PRPF31 monoclonal antibody (M02), clone 8E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PRPF31. |
| Clone: | 8E1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26121 |
| Gene name: | PRPF31 |
| Gene alias: | DKFZp566J153|NY-BR-99|PRP31|RP11 |
| Gene description: | PRP31 pre-mRNA processing factor 31 homolog (S. cerevisiae) |
| Genbank accession: | NM_015629 |
| Immunogen: | PRPF31 (NP_056444, 400 a.a. ~ 499 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST |
| Protein accession: | NP_056444 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | PRPF31 monoclonal antibody (M02), clone 8E1. Western Blot analysis of PRPF31 expression in human liver. |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | An integrative analysis of colon cancer identifies an essential function for PRPF6 in tumor growth.Adler AS, McCleland ML, Yee S, Yaylaoglu M, Hussain S, Cosino E, Quinones G, Modrusan Z, Seshagiri S, Torres E, Chopra VS, Haley B, Zhang Z, Blackwood EM, Singh M, Junttila M, Stephan JP, Liu J, Pau G, Fearon ER, Jiang Z, Firestein R Genes Dev. 2014 May 15;28(10):1068-84. doi: 10.1101/gad.237206.113. Epub 2014 May 1. |