| Brand: | Abnova |
| Reference: | H00026063-M03 |
| Product name: | DECR2 monoclonal antibody (M03), clone 4A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DECR2. |
| Clone: | 4A7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 26063 |
| Gene name: | DECR2 |
| Gene alias: | PDCR|SDR17C1 |
| Gene description: | 2,4-dienoyl CoA reductase 2, peroxisomal |
| Genbank accession: | BC010740 |
| Immunogen: | DECR2 (AAH10740.1, 49 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDI |
| Protein accession: | AAH10740.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.12 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DECR2 monoclonal antibody (M03), clone 4A7. Western Blot analysis of DECR2 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |