Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DECR2 MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr,IP |
More info about DECR2 MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00026063-D01 |
| Product name: | DECR2 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human DECR2 protein. |
| Gene id: | 26063 |
| Gene name: | DECR2 |
| Gene alias: | PDCR|SDR17C1 |
| Gene description: | 2,4-dienoyl CoA reductase 2, peroxisomal |
| Genbank accession: | NM_020664 |
| Immunogen: | DECR2 (NP_065715.1, 1 a.a. ~ 292 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL |
| Protein accession: | NP_065715.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of DECR2 transfected lysate using anti-DECR2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DECR2 purified MaxPab mouse polyclonal antibody (B01P) (H00026063-B01P). |
| Applications: | WB-Tr,IP |
| Shipping condition: | Dry Ice |