| Brand: | Abnova |
| Reference: | H00026060-A01 |
| Product name: | APPL polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant APPL. |
| Gene id: | 26060 |
| Gene name: | APPL1 |
| Gene alias: | APPL|DIP13alpha |
| Gene description: | adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 |
| Genbank accession: | NM_012096 |
| Immunogen: | APPL (NP_036228, 611 a.a. ~ 708 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESE |
| Protein accession: | NP_036228 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | APPL polyclonal antibody (A01), Lot # HRI0060508QCS1 Western Blot analysis of APPL expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |