APPL polyclonal antibody (A01) View larger

APPL polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APPL polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about APPL polyclonal antibody (A01)

Brand: Abnova
Reference: H00026060-A01
Product name: APPL polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant APPL.
Gene id: 26060
Gene name: APPL1
Gene alias: APPL|DIP13alpha
Gene description: adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
Genbank accession: NM_012096
Immunogen: APPL (NP_036228, 611 a.a. ~ 708 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: EGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESE
Protein accession: NP_036228
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00026060-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00026060-A01-1-1-1.jpg
Application image note: APPL polyclonal antibody (A01), Lot # HRI0060508QCS1 Western Blot analysis of APPL expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy APPL polyclonal antibody (A01) now

Add to cart