Cart 14 Product Products 5 306,00 € (empty)
No products
To be determined Shipping
5 306,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 14 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 306,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 306,00 €
Data sheet of ANKRD17 monoclonal antibody (M01A), clone 1D8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about ANKRD17 monoclonal antibody (M01A), clone 1D8
| Brand: | Abnova |
| Reference: | H00026057-M01A |
| Product name: | ANKRD17 monoclonal antibody (M01A), clone 1D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ANKRD17. |
| Clone: | 1D8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 26057 |
| Gene name: | ANKRD17 |
| Gene alias: | FLJ22206|GTAR|KIAA0697|NY-BR-16 |
| Gene description: | ankyrin repeat domain 17 |
| Genbank accession: | NM_032217 |
| Immunogen: | ANKRD17 (NP_115593, 2501 a.a. ~ 2603 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ERDSTGIVTPSGTFHQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSVHMNQLG |
| Protein accession: | NP_115593 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |