Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00026040-B01 |
Product name: | SETBP1 MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human SETBP1 protein. |
Gene id: | 26040 |
Gene name: | SETBP1 |
Gene alias: | KIAA0437|SEB |
Gene description: | SET binding protein 1 |
Genbank accession: | BC062338 |
Immunogen: | SETBP1 (AAH62338.1, 1 a.a. ~ 242 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MESRETLSSSRQRGGESDFLPVSSAKPPAAPGCAGEPLLSTPGPGKGIPVGGERMEPEEEDELGSGRDVDSNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNLENYICPPEIKITIKQSGDQKVSRAGKNSKATKEEERSHSKKKLLTASDLAASDLKGFQPQIKDSSKEEVWKRRGGQGIPFKKQFLSQERAMCFSCPRNPFPAKPGSLTLPFHSEPAVWAQEV |
Protein accession: | AAH62338.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SETBP1 expression in transfected 293T cell line (H00026040-T01) by SETBP1 MaxPab polyclonal antibody. Lane 1: SETBP1 transfected lysate(26.62 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Reduced expression by SETBP1 haploinsufficiency causes developmental and expressive language delay indicating a phenotype distinct from Schinzel-Giedion syndrome.Filges I, Shimojima K, Okamoto N, Rothlisberger B, Weber P, Huber AR, Nishizawa T, Datta AN, Miny P, Yamamoto T. J Med Genet. 2010 Oct 30. [Epub ahead of print] |