| Brand: | Abnova |
| Reference: | H00026027-M01 |
| Product name: | THEA monoclonal antibody (M01), clone 4D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant THEA. |
| Clone: | 4D1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 26027 |
| Gene name: | ACOT11 |
| Gene alias: | BFIT|BFIT1|BFIT2|KIAA0707|STARD14|THEA|THEM1 |
| Gene description: | acyl-CoA thioesterase 11 |
| Genbank accession: | BC001517 |
| Immunogen: | THEA (AAH01517, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MADGEGYRNPTEVQMSQLVLPCHTNQRGELSVGQLLKWIDTTACLSAERHAGCPCVTASMDDIYFEHTISVGQVVNIKAKVNRAFNSSMEVGIQVASEDLCSEKQWNVCK |
| Protein accession: | AAH01517 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ACOT11 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |