Brand: | Abnova |
Reference: | H00026002-A01 |
Product name: | MOXD1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MOXD1. |
Gene id: | 26002 |
Gene name: | MOXD1 |
Gene alias: | DKFZp564G202|MOX|PRO5780|dJ248E1.1 |
Gene description: | monooxygenase, DBH-like 1 |
Genbank accession: | NM_015529 |
Immunogen: | MOXD1 (NP_056344, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | DYFTNANRELKKDAQQDYHLEYAMENSTHTIIEFTRELHTCDINDKSITDSTVRVIWAYHHEDAGEAGPKYHDSNRGTKSLRLLNPEKTSVLSTALPYFD |
Protein accession: | NP_056344 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MOXD1 polyclonal antibody (A01), Lot # 060717JCS1. Western Blot analysis of MOXD1 expression in Daoy. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |