No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
| Brand: | Abnova |
| Reference: | H00025999-M09 |
| Product name: | CLIP3 monoclonal antibody (M09), clone 4C11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CLIP3. |
| Clone: | 4C11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 25999 |
| Gene name: | CLIP3 |
| Gene alias: | CLIPR-59|CLIPR59|DKFZp586N1922|FLJ33413|RSNL1 |
| Gene description: | CAP-GLY domain containing linker protein 3 |
| Genbank accession: | NM_015526 |
| Immunogen: | CLIP3 (NP_056341, 447 a.a. ~ 547 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTDSPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQS |
| Protein accession: | NP_056341 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged CLIP3 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |