| Brand: | Abnova |
| Reference: | H00025978-M01 |
| Product name: | CHMP2B monoclonal antibody (M01), clone 2H6-1E6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CHMP2B. |
| Clone: | 2H6-1E6 |
| Isotype: | IgG1 kappa |
| Gene id: | 25978 |
| Gene name: | CHMP2B |
| Gene alias: | CHMP2.5|DKFZp564O123|DMT1|VPS2-2|VPS2B |
| Gene description: | chromatin modifying protein 2B |
| Genbank accession: | BC001553.1 |
| Immunogen: | CHMP2B (AAH01553.1, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD |
| Protein accession: | AAH01553.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CHMP2B is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |