MMACHC purified MaxPab rabbit polyclonal antibody (D01P) View larger

MMACHC purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MMACHC purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about MMACHC purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00025974-D01P
Product name: MMACHC purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human MMACHC protein.
Gene id: 25974
Gene name: MMACHC
Gene alias: DKFZp564I122|FLJ25671|RP11-291L19.3
Gene description: methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria
Genbank accession: BC006122
Immunogen: MMACHC (AAH06122.3, 1 a.a. ~ 225 a.a) full-length human protein.
Immunogen sequence/protein sequence: MFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASPGP
Protein accession: AAH06122.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00025974-D01P-13-15-1.jpg
Application image note: Western Blot analysis of MMACHC expression in transfected 293T cell line (H00025974-T02) by MMACHC MaxPab polyclonal antibody.

Lane 1: MMACHC transfected lysate(25.30 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MMACHC purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart