| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00025970-M01 |
| Product name: | SH2B monoclonal antibody (M01), clone 2B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SH2B. |
| Clone: | 2B9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 25970 |
| Gene name: | SH2B1 |
| Gene alias: | DKFZp547G1110|FLJ30542|KIAA1299|SH2-B|SH2B |
| Gene description: | SH2B adaptor protein 1 |
| Genbank accession: | BC010704 |
| Immunogen: | SH2B (AAH10704, 327 a.a. ~ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQGREQAGSHAGVCEGDGCHPDASCTLMPFGASDCVTDHLP |
| Protein accession: | AAH10704 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SH2B1 expression in transfected 293T cell line by SH2B1 monoclonal antibody (M01), clone 2B9. Lane 1: SH2B1 transfected lysate(52.917 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |