Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00025970-B01P |
Product name: | SH2B purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human SH2B protein. |
Gene id: | 25970 |
Gene name: | SH2B1 |
Gene alias: | DKFZp547G1110|FLJ30542|KIAA1299|SH2-B|SH2B |
Gene description: | SH2B adaptor protein 1 |
Genbank accession: | BC010704 |
Immunogen: | SH2B (AAH10704.1, 1 a.a. ~ 426 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVDAQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEGPPAGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQLALTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQGREQAGSHAGVCEGDGCHPDASCTLMPFGASDCVTDHLP |
Protein accession: | AAH10704.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SH2B1 expression in transfected 293T cell line (H00025970-T01) by SH2B1 MaxPab polyclonal antibody. Lane 1: SH2B transfected lysate(46.86 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,IF,WB-Tr |
Shipping condition: | Dry Ice |