No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00025913-A01 |
Product name: | POT1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant POT1. |
Gene id: | 25913 |
Gene name: | POT1 |
Gene alias: | DKFZp586D211|hPot1 |
Gene description: | POT1 protection of telomeres 1 homolog (S. pombe) |
Genbank accession: | NM_015450 |
Immunogen: | POT1 (NP_056265, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQG |
Protein accession: | NP_056265 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.56 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | POT1 polyclonal antibody (A01), Lot # 060524JCS1 Western Blot analysis of POT1 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |