POT1 polyclonal antibody (A01) View larger

POT1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POT1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about POT1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00025913-A01
Product name: POT1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant POT1.
Gene id: 25913
Gene name: POT1
Gene alias: DKFZp586D211|hPot1
Gene description: POT1 protection of telomeres 1 homolog (S. pombe)
Genbank accession: NM_015450
Immunogen: POT1 (NP_056265, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQG
Protein accession: NP_056265
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025913-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.56 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025913-A01-1-22-1.jpg
Application image note: POT1 polyclonal antibody (A01), Lot # 060524JCS1 Western Blot analysis of POT1 expression in MES-SA/Dx5 ( Cat # L021V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy POT1 polyclonal antibody (A01) now

Add to cart