| Brand: | Abnova |
| Reference: | H00025913-A01 |
| Product name: | POT1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant POT1. |
| Gene id: | 25913 |
| Gene name: | POT1 |
| Gene alias: | DKFZp586D211|hPot1 |
| Gene description: | POT1 protection of telomeres 1 homolog (S. pombe) |
| Genbank accession: | NM_015450 |
| Immunogen: | POT1 (NP_056265, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQG |
| Protein accession: | NP_056265 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.56 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | POT1 polyclonal antibody (A01), Lot # 060524JCS1 Western Blot analysis of POT1 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |