Brand: | Abnova |
Reference: | H00025902-A01 |
Product name: | MTHFD1L polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MTHFD1L. |
Gene id: | 25902 |
Gene name: | MTHFD1L |
Gene alias: | DKFZp586G1517|FLJ21145|FTHFSDC1|MTC1THFS|dJ292B18.2 |
Gene description: | methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like |
Genbank accession: | NM_015440 |
Immunogen: | MTHFD1L (NP_056255, 801 a.a. ~ 899 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | VFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQG |
Protein accession: | NP_056255 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MTHFD1L polyclonal antibody (A01), Lot # 051213JC01 Western Blot analysis of MTHFD1L expression in 293 ( Cat # L026V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |