| Brand: | Abnova |
| Reference: | H00025890-M15 |
| Product name: | ABI3BP monoclonal antibody (M15), clone 2B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ABI3BP. |
| Clone: | 2B8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 25890 |
| Gene name: | ABI3BP |
| Gene alias: | FLJ41743|FLJ41754|NESHBP|TARSH |
| Gene description: | ABI family, member 3 (NESH) binding protein |
| Genbank accession: | NM_015429 |
| Immunogen: | ABI3BP (NP_056244.2, 511 a.a. ~ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KTQFISLKPKIPLSPEVTHTKPAPKQTPRAPPKPKTSPRPRIPQTQPVPKVPQRVTAKPKTSPSPEVSYTTPAPKDVLLPHKPYPEVSQSEPAPLETRG |
| Protein accession: | NP_056244.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ABI3BP is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |