No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00025890-M15 |
Product name: | ABI3BP monoclonal antibody (M15), clone 2B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ABI3BP. |
Clone: | 2B8 |
Isotype: | IgG2b Kappa |
Gene id: | 25890 |
Gene name: | ABI3BP |
Gene alias: | FLJ41743|FLJ41754|NESHBP|TARSH |
Gene description: | ABI family, member 3 (NESH) binding protein |
Genbank accession: | NM_015429 |
Immunogen: | ABI3BP (NP_056244.2, 511 a.a. ~ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KTQFISLKPKIPLSPEVTHTKPAPKQTPRAPPKPKTSPRPRIPQTQPVPKVPQRVTAKPKTSPSPEVSYTTPAPKDVLLPHKPYPEVSQSEPAPLETRG |
Protein accession: | NP_056244.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged ABI3BP is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |