SUMF2 polyclonal antibody (A01) View larger

SUMF2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUMF2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SUMF2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00025870-A01
Product name: SUMF2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SUMF2.
Gene id: 25870
Gene name: SUMF2
Gene alias: DKFZp566I1024|DKFZp686I1024|DKFZp686L17160|DKFZp781L1035|MGC99485|pFGE
Gene description: sulfatase modifying factor 2
Genbank accession: NM_015411
Immunogen: SUMF2 (NP_056226, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: QATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAF
Protein accession: NP_056226
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00025870-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025870-A01-1-12-1.jpg
Application image note: SUMF2 polyclonal antibody (A01), Lot # 060619JCS1 Western Blot analysis of SUMF2 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SUMF2 polyclonal antibody (A01) now

Add to cart