ARMC8 MaxPab mouse polyclonal antibody (B01) View larger

ARMC8 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARMC8 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ARMC8 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00025852-B01
Product name: ARMC8 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human ARMC8 protein.
Gene id: 25852
Gene name: ARMC8
Gene alias: HSPC056|MGC10058|MGC4880|S863-2
Gene description: armadillo repeat containing 8
Genbank accession: NM_014154.2
Immunogen: ARMC8 (NP_054873.2, 1 a.a. ~ 385 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST
Protein accession: NP_054873.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00025852-B01-13-15-1.jpg
Application image note: Western Blot analysis of ARMC8 expression in transfected 293T cell line (H00025852-T01) by ARMC8 MaxPab polyclonal antibody.

Lane 1: ARMC8 transfected lysate(42.35 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ARMC8 MaxPab mouse polyclonal antibody (B01) now

Add to cart