| Brand: | Abnova |
| Reference: | H00025824-D01 |
| Product name: | PRDX5 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human PRDX5 protein. |
| Gene id: | 25824 |
| Gene name: | PRDX5 |
| Gene alias: | ACR1|AOEB166|B166|MGC117264|MGC142283|MGC142285|PLP|PMP20|PRDX6|PRXV|SBBI10 |
| Gene description: | peroxiredoxin 5 |
| Genbank accession: | NM_012094.3 |
| Immunogen: | PRDX5 (NP_036226.1, 1 a.a. ~ 214 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL |
| Protein accession: | NP_036226.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of PRDX5 transfected lysate using anti-PRDX5 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PRDX5 MaxPab mouse polyclonal antibody (B01) (H00025824-B01). |
| Applications: | IP |
| Shipping condition: | Dry Ice |