View larger

KLK5 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of KLK5 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00025818-A01
Product name:	KLK5 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant KLK5.
Gene id:	25818
Gene name:	KLK5
Gene alias:	KLK-L2\|KLKL2\|SCTE
Gene description:	kallikrein-related peptidase 5
Genbank accession:	NM_012427
Immunogen:	KLK5 (NP_036559, 194 a.a. ~ 293 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	KSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Protein accession:	NP_036559
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.11 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice