| Brand: | Abnova |
| Reference: | H00025816-A01 |
| Product name: | TNFAIP8 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant TNFAIP8. |
| Gene id: | 25816 |
| Gene name: | TNFAIP8 |
| Gene alias: | GG2-1|MDC-3.13|SCC-S2|SCCS2 |
| Gene description: | tumor necrosis factor, alpha-induced protein 8 |
| Genbank accession: | BC005352 |
| Immunogen: | TNFAIP8 (AAH05352, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI |
| Protein accession: | AAH05352 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (47.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |