No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00025805-M01 |
| Product name: | BAMBI monoclonal antibody (M01), clone 3C1-1D1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant BAMBI. |
| Clone: | 3C1-1D1 |
| Isotype: | IgG1 kappa |
| Gene id: | 25805 |
| Gene name: | BAMBI |
| Gene alias: | NMA |
| Gene description: | BMP and activin membrane-bound inhibitor homolog (Xenopus laevis) |
| Genbank accession: | BC019252 |
| Immunogen: | BAMBI (AAH19252, 1 a.a. ~ 260 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLTLVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV |
| Protein accession: | AAH19252 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (54.34 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of BAMBI expression in transfected 293T cell line by BAMBI monoclonal antibody (M01), clone 3C1-1D1. Lane 1: BAMBI transfected lysate(29.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Human trabecular meshwork cells express BMP antagonist mRNAs and proteins.Tovar-Vidales T, Fitzgerald AM, Clark AF. Exp Eye Res. 2016 May 7. [Epub ahead of print] |