Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SPDEF monoclonal antibody (M01), clone 4A5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about SPDEF monoclonal antibody (M01), clone 4A5
| Brand: | Abnova |
| Reference: | H00025803-M01 |
| Product name: | SPDEF monoclonal antibody (M01), clone 4A5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SPDEF. |
| Clone: | 4A5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 25803 |
| Gene name: | SPDEF |
| Gene alias: | PDEF|RP11-375E1__A.3|bA375E1.3 |
| Gene description: | SAM pointed domain containing ets transcription factor |
| Genbank accession: | NM_012391 |
| Immunogen: | SPDEF (NP_036523, 92 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGD |
| Protein accession: | NP_036523 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SPDEF expression in transfected 293T cell line by SPDEF monoclonal antibody (M01), clone 4A5. Lane 1: SPDEF transfected lysate(37.518 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |