Brand: | Abnova |
Reference: | H00025788-D01P |
Product name: | RAD54B purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human RAD54B protein. |
Gene id: | 25788 |
Gene name: | RAD54B |
Gene alias: | FSBP|RDH54 |
Gene description: | RAD54 homolog B (S. cerevisiae) |
Genbank accession: | BC033710 |
Immunogen: | RAD54B (AAH33710.2, 1 a.a. ~ 158 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL |
Protein accession: | AAH33710.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RAD54B MaxPab rabbit polyclonal antibody. Western Blot analysis of RAD54B expression in human stomach. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |