| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00025778-M08 |
| Product name: | DSTYK monoclonal antibody (M08), clone 4D5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DSTYK. |
| Clone: | 4D5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 25778 |
| Gene name: | DSTYK |
| Gene alias: | DustyPK|HDCMD38P|KIAA0472|RIP5|RIPK5 |
| Gene description: | dual serine/threonine and tyrosine protein kinase |
| Genbank accession: | NM_015375 |
| Immunogen: | DSTYK (NP_056190, 80 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQDCNVKCQLLNLLLGVQVLPTTKLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAHQGNWETIPE |
| Protein accession: | NP_056190 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of DSTYK expression in transfected 293T cell line by DSTYK monoclonal antibody (M08), clone 4D5. Lane 1: DSTYK transfected lysate (Predicted MW: 66.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |