No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023784-M07 |
Product name: | POTEH monoclonal antibody (M07), clone 3G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant POTEH. |
Clone: | 3G10 |
Isotype: | IgG2a Kappa |
Gene id: | 23784 |
Gene name: | POTEH |
Gene alias: | A26C3|ACTBL1|POTE22 |
Gene description: | POTE ankyrin domain family, member H |
Genbank accession: | NM_001004053 |
Immunogen: | POTEH (NP_001004053, 189 a.a. ~ 288 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VPRKDLIVMLKDTDMNKKDKQKRTALHLASANGNSEVVKLLLDRRCQLNVLDNKKRTALTKAVQCQEDECALMLLEHGTDPNIPDEYGNTALHYAIYNED |
Protein accession: | NP_001004053 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | POTEH monoclonal antibody (M07), clone 3G10. Western Blot analysis of POTEH expression in K-562(Cat # L009V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |