| Brand: | Abnova |
| Reference: | H00023760-M05 |
| Product name: | PITPNB monoclonal antibody (M05), clone 3D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PITPNB. |
| Clone: | 3D3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23760 |
| Gene name: | PITPNB |
| Gene alias: | PI-TP-beta|PtdInsTP|VIB1B |
| Gene description: | phosphatidylinositol transfer protein, beta |
| Genbank accession: | NM_012399 |
| Immunogen: | PITPNB (NP_036531, 181 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV |
| Protein accession: | NP_036531 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PITPNB monoclonal antibody (M05), clone 3D3. Western Blot analysis of PITPNB expression in Jurkat(Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |