No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00023760-M05 |
Product name: | PITPNB monoclonal antibody (M05), clone 3D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PITPNB. |
Clone: | 3D3 |
Isotype: | IgG2a Kappa |
Gene id: | 23760 |
Gene name: | PITPNB |
Gene alias: | PI-TP-beta|PtdInsTP|VIB1B |
Gene description: | phosphatidylinositol transfer protein, beta |
Genbank accession: | NM_012399 |
Immunogen: | PITPNB (NP_036531, 181 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV |
Protein accession: | NP_036531 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | PITPNB monoclonal antibody (M05), clone 3D3. Western Blot analysis of PITPNB expression in Jurkat(Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |