No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,IP |
Brand: | Abnova |
Reference: | H00023746-M23 |
Product name: | AIPL1 monoclonal antibody (M23), clone 3A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AIPL1. |
Clone: | 3A3 |
Isotype: | IgG2b Kappa |
Gene id: | 23746 |
Gene name: | AIPL1 |
Gene alias: | AIPL2|LCA4 |
Gene description: | aryl hydrocarbon receptor interacting protein-like 1 |
Genbank accession: | NM_014336 |
Immunogen: | AIPL1 (NP_055151.3, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLEVWEILLTSMRVHEVAEFWCDTIHTGVYPILS |
Protein accession: | NP_055151.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged AIPL1 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |