Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CRI1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about CRI1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00023741-A01 |
| Product name: | CRI1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CRI1. |
| Gene id: | 23741 |
| Gene name: | EID1 |
| Gene alias: | C15orf3|CRI1|EID-1|IRO45620|MGC138883|MGC138884|PNAS-22|PTD014|RBP21 |
| Gene description: | EP300 interacting inhibitor of differentiation 1 |
| Genbank accession: | NM_014335 |
| Immunogen: | CRI1 (NP_055150, 116 a.a. ~ 187 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | QLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE |
| Protein accession: | NP_055150 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.03 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |