No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023682-M02 |
Product name: | RAB38 monoclonal antibody (M02), clone 7F1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB38. |
Clone: | 7F1 |
Isotype: | IgG2b Kappa |
Gene id: | 23682 |
Gene name: | RAB38 |
Gene alias: | NY-MEL-1|rrGTPbp |
Gene description: | RAB38, member RAS oncogene family |
Genbank accession: | NM_022337 |
Immunogen: | RAB38 (NP_071732, 115 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS |
Protein accession: | NP_071732 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | RAB38 monoclonal antibody (M02), clone 7F1 Western Blot analysis of RAB38 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | miRNA Expression Profiling in Melanocytes and Melanoma Cell Lines Reveals miRNAs Associated with Formation and Progression of Malignant Melanoma.Mueller DW, Rehli M, Bosserhoff AK. J Invest Dermatol. 2009 Jul;129(7):1740-51. Epub 2009 Feb 12. |