No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023678-M02 |
Product name: | SGKL monoclonal antibody (M02), clone 2A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SGKL. |
Clone: | 2A7 |
Isotype: | IgG2b Kappa |
Gene id: | 23678 |
Gene name: | SGK3 |
Gene alias: | CISK|DKFZp781N0293|SGK2|SGKL |
Gene description: | serum/glucocorticoid regulated kinase family, member 3 |
Genbank accession: | BC015326 |
Immunogen: | SGKL (AAH15326, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSE |
Protein accession: | AAH15326 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (39.93 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to SGK3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |