| Brand: | Abnova |
| Reference: | H00023678-M02 |
| Product name: | SGKL monoclonal antibody (M02), clone 2A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SGKL. |
| Clone: | 2A7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 23678 |
| Gene name: | SGK3 |
| Gene alias: | CISK|DKFZp781N0293|SGK2|SGKL |
| Gene description: | serum/glucocorticoid regulated kinase family, member 3 |
| Genbank accession: | BC015326 |
| Immunogen: | SGKL (AAH15326, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSE |
| Protein accession: | AAH15326 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.93 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SGK3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |