| Brand: | Abnova |
| Reference: | H00023659-M01 |
| Product name: | LYPLA3 monoclonal antibody (M01), clone 3B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LYPLA3. |
| Clone: | 3B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23659 |
| Gene name: | PLA2G15 |
| Gene alias: | ACS|DKFZp564A0122|GXVPLA2|LLPL|LPLA2|LYPLA3 |
| Gene description: | phospholipase A2, group XV |
| Genbank accession: | NM_012320 |
| Immunogen: | LYPLA3 (NP_036452, 314 a.a. ~ 412 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP |
| Protein accession: | NP_036452 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | LYPLA3 monoclonal antibody (M01), clone 3B11 Western Blot analysis of LYPLA3 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |