Product successfully added to your shopping cart
Quantity
Total
There are 4 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 546,07 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 546,07 €
Data sheet of LYPLA3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about LYPLA3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00023659-A01 |
| Product name: | LYPLA3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LYPLA3. |
| Gene id: | 23659 |
| Gene name: | PLA2G15 |
| Gene alias: | ACS|DKFZp564A0122|GXVPLA2|LLPL|LPLA2|LYPLA3 |
| Gene description: | phospholipase A2, group XV |
| Genbank accession: | NM_012320 |
| Immunogen: | LYPLA3 (NP_036452, 314 a.a. ~ 412 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | TEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP |
| Protein accession: | NP_036452 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |