| Brand: | Abnova |
| Reference: | H00023648-M01 |
| Product name: | SSBP3 monoclonal antibody (M01), clone 3E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SSBP3. |
| Clone: | 3E6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 23648 |
| Gene name: | SSBP3 |
| Gene alias: | CSDP|FLJ10355|SSDP|SSDP1 |
| Gene description: | single stranded DNA binding protein 3 |
| Genbank accession: | NM_018070 |
| Immunogen: | SSBP3 (NP_060540, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVL |
| Protein accession: | NP_060540 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SSBP3 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Proteasomal selection of multiprotein complexes recruited by LIM homeodomain transcription factors.Gungor C, Taniguchi-Ishigaki N, Ma H, Drung A, Tursun B, Ostendorff HP, Bossenz M, Becker CG, Becker T, Bach I. Proc Natl Acad Sci U S A. 2007 Sep 18;104(38):15000-5. Epub 2007 Sep 11. |