Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ARFIP2 monoclonal antibody (M01), clone 2B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about ARFIP2 monoclonal antibody (M01), clone 2B5
| Brand: | Abnova |
| Reference: | H00023647-M01 |
| Product name: | ARFIP2 monoclonal antibody (M01), clone 2B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ARFIP2. |
| Clone: | 2B5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 23647 |
| Gene name: | ARFIP2 |
| Gene alias: | POR1 |
| Gene description: | ADP-ribosylation factor interacting protein 2 |
| Genbank accession: | BC000392 |
| Immunogen: | ARFIP2 (AAH00392, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQL |
| Protein accession: | AAH00392 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ARFIP2 monoclonal antibody (M01), clone 2B5 Western Blot analysis of ARFIP2 expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Recruitment of arfaptins to the trans-Golgi network by PI(4)P and their involvement in cargo export.Cruz-Garcia D, Ortega-Bellido M, Scarpa M, Villeneuve J, Jovic M, Porzner M, Balla T, Seufferlein T, Malhotra V EMBO J. 2013 Jun 12;32(12):1717-29. doi: 10.1038/emboj.2013.116. Epub 2013 May 21. |