No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,IF,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00023644-M01 |
Product name: | EDC4 monoclonal antibody (M01), clone 2E2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EDC4. |
Clone: | 2E2 |
Isotype: | IgG2a Kappa |
Gene id: | 23644 |
Gene name: | EDC4 |
Gene alias: | Ge-1|HEDLS|RCD-8 |
Gene description: | enhancer of mRNA decapping 4 |
Genbank accession: | NM_014329 |
Immunogen: | EDC4 (NP_055144.3, 1302 a.a. ~ 1401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAEPHNSLGKAARRLSLMLHGLVTPSLP |
Protein accession: | NP_055144.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to EDC4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |