LY96 MaxPab mouse polyclonal antibody (B03) View larger

LY96 MaxPab mouse polyclonal antibody (B03)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LY96 MaxPab mouse polyclonal antibody (B03)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about LY96 MaxPab mouse polyclonal antibody (B03)

Brand: Abnova
Reference: H00023643-B03
Product name: LY96 MaxPab mouse polyclonal antibody (B03)
Product description: Mouse polyclonal antibody raised against a full-length human LY96 protein.
Gene id: 23643
Gene name: LY96
Gene alias: MD-2|MD2
Gene description: lymphocyte antigen 96
Genbank accession: BC020690
Immunogen: LY96 (AAH20690, 19 a.a. ~ 160 a.a) full-length human protein.
Immunogen sequence/protein sequence: QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Protein accession: AAH20690
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023643-B03-13-15-1.jpg
Application image note: Western Blot analysis of LY96 expression in transfected 293T cell line (H00023643-T03) by LY96 MaxPab polyclonal antibody.

Lane 1: LY96 transfected lysate(17.71 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LY96 MaxPab mouse polyclonal antibody (B03) now

Add to cart