No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00023632-B01P |
Product name: | CA14 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human CA14 protein. |
Gene id: | 23632 |
Gene name: | CA14 |
Gene alias: | - |
Gene description: | carbonic anhydrase XIV |
Genbank accession: | NM_012113.1 |
Immunogen: | CA14 (NP_036245.1, 1 a.a. ~ 337 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA |
Protein accession: | NP_036245.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CA14 expression in transfected 293T cell line (H00023632-T01) by CA14 MaxPab polyclonal antibody. Lane 1: CA14 transfected lysate(37.07 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Rest interval duration does not influence adaptations in acid/base transport proteins following 10 weeks of sprint-interval training in active women.McGinley C, Bishop DJ. Am J Physiol Regul Integr Comp Physiol. 2017 Feb 1. [Epub ahead of print] |