No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00023626-A01 |
| Product name: | SPO11 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SPO11. |
| Gene id: | 23626 |
| Gene name: | SPO11 |
| Gene alias: | MGC39953 |
| Gene description: | SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae) |
| Genbank accession: | NM_012444 |
| Immunogen: | SPO11 (NP_036576, 291 a.a. ~ 395 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | YGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGW |
| Protein accession: | NP_036576 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.66 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | SPO11 polyclonal antibody (A01), Lot # 061025JCS1 Western Blot analysis of SPO11 expression in SJCRH30 ( Cat # L027V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |