| Brand: | Abnova |
| Reference: | H00023617-M02 |
| Product name: | TSSK2 monoclonal antibody (M02), clone 1H2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TSSK2. |
| Clone: | 1H2 |
| Isotype: | IgG |
| Gene id: | 23617 |
| Gene name: | TSSK2 |
| Gene alias: | DGS-G|FLJ38613|SPOGA2|STK22B |
| Gene description: | testis-specific serine kinase 2 |
| Genbank accession: | BC037781 |
| Immunogen: | TSSK2 (AAH37781, 265 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EILSHSWLQPPKPKATSSASFKREGEGKYRAECKLDTKTDLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISGAEVGKAST |
| Protein accession: | AAH37781 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.97 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to TSSK2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |