No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023613-M01 |
Product name: | ZMYND8 monoclonal antibody (M01), clone 5B12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZMYND8. |
Clone: | 5B12 |
Isotype: | IgG1 Kappa |
Gene id: | 23613 |
Gene name: | ZMYND8 |
Gene alias: | MGC31836|PRKCBP1|PRO2893|RACK7 |
Gene description: | zinc finger, MYND-type containing 8 |
Genbank accession: | NM_183048 |
Immunogen: | ZMYND8 (NP_898869, 601 a.a. ~ 698 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHL |
Protein accession: | NP_898869 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | ZMYND8 monoclonal antibody (M01), clone 5B12 Western Blot analysis of ZMYND8 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Physical and functional interactions between the histone H3K4 demethylase KDM5A and the nucleosome remodeling and deacetylase (NuRD) complex.Nishibuchi G, Shibata Y, Hayakawa T, Hayakawa N, Ohtani Y, Sinmyozu K, Tagami H, Nakayama J. J Biol Chem. 2014 Oct 17;289(42):28956-70. doi: 10.1074/jbc.M114.573725. Epub 2014 Sep 4. |