| Brand: | Abnova |
| Reference: | H00023609-M01 |
| Product name: | MKRN2 monoclonal antibody (M01), clone 5F8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MKRN2. |
| Clone: | 5F8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 23609 |
| Gene name: | MKRN2 |
| Gene alias: | HSPC070|RNF62 |
| Gene description: | makorin ring finger protein 2 |
| Genbank accession: | NM_014160 |
| Immunogen: | MKRN2 (NP_054879, 317 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSE |
| Protein accession: | NP_054879 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MKRN2 monoclonal antibody (M01), clone 5F8 Western Blot analysis of MKRN2 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |