Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CORO1C monoclonal antibody (M02), clone 1F7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about CORO1C monoclonal antibody (M02), clone 1F7
| Brand: | Abnova |
| Reference: | H00023603-M02 |
| Product name: | CORO1C monoclonal antibody (M02), clone 1F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CORO1C. |
| Clone: | 1F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23603 |
| Gene name: | CORO1C |
| Gene alias: | HCRNN4 |
| Gene description: | coronin, actin binding protein, 1C |
| Genbank accession: | NM_014325 |
| Immunogen: | CORO1C (NP_055140, 375 a.a. ~ 473 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIA |
| Protein accession: | NP_055140 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CORO1C monoclonal antibody (M02), clone 1F7. Western Blot analysis of CORO1C expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Activated Cdc42-Bound IQGAP1 Determines the Cellular Endocytic Site.Kimura T, Yamaoka M, Taniguchi S, Okamoto M, Takei M, Ando T, Iwamatsu A, Watanabe T, Kaibuchi K, Ishizaki T, Niki I Mol Cell Biol. 2013 Dec;33(24):4834-43. doi: 10.1128/MCB.00895-13. Epub 2013 Oct 7. |