| Brand: | Abnova |
| Reference: | H00023595-M01 |
| Product name: | ORC3L monoclonal antibody (M01), clone 3D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ORC3L. |
| Clone: | 3D3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23595 |
| Gene name: | ORC3L |
| Gene alias: | LAT|LATHEO|ORC3 |
| Gene description: | origin recognition complex, subunit 3-like (yeast) |
| Genbank accession: | BC035494 |
| Immunogen: | ORC3L (AAH35494, 602 a.a. ~ 711 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC |
| Protein accession: | AAH35494 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ORC3L is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |