No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00023583-M07 |
Product name: | SMUG1 monoclonal antibody (M07), clone 4D5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SMUG1. |
Clone: | 4D5 |
Isotype: | IgG1 Kappa |
Gene id: | 23583 |
Gene name: | SMUG1 |
Gene alias: | FDG|HMUDG|MGC104370|UNG3 |
Gene description: | single-strand-selective monofunctional uracil-DNA glycosylase 1 |
Genbank accession: | BC000417.2 |
Immunogen: | SMUG1 (AAH00417.1, 1 a.a. ~ 177 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL |
Protein accession: | AAH00417.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (46 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SMUG1 expression in transfected 293T cell line by SMUG1 monoclonal antibody (M07), clone 4D5. Lane 1: SMUG1 transfected lysate (Predicted MW: 19.6 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |