SMUG1 purified MaxPab mouse polyclonal antibody (B01P) View larger

SMUG1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMUG1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SMUG1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00023583-B01P
Product name: SMUG1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SMUG1 protein.
Gene id: 23583
Gene name: SMUG1
Gene alias: FDG|HMUDG|MGC104370|UNG3
Gene description: single-strand-selective monofunctional uracil-DNA glycosylase 1
Genbank accession: BC000417.2
Immunogen: SMUG1 (AAH00417.1, 1 a.a. ~ 177 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL
Protein accession: AAH00417.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023583-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SMUG1 expression in transfected 293T cell line (H00023583-T01) by SMUG1 MaxPab polyclonal antibody.

Lane 1: SMUG1 transfected lysate(19.47 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SMUG1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart